SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012630 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012630
Domain Number 1 Region: 4-285
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 7.59e-109
Family Inorganic pyrophosphatase 0.0000000479
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012630   Gene: ENSCPOG00000014023   Transcript: ENSCPOT00000014165
Sequence length 289
Comment pep:known_by_projection scaffold:cavPor3:scaffold_15:19576305:19609992:-1 gene:ENSCPOG00000014023 transcript:ENSCPOT00000014165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGYSSEERAAPFTLEYRVFLKNEKGQYVSPFHDIPIYADKDIFHMVVEVPRWSNAKMEI
ATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHSDKHTGCCGDNDPI
DVCEIGSKVCARGEIIRVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVERLKP
GYLEATVDWFRRYKVPDGKPENQFAFNAEFKDKNFAVDIIKSTHDYWKALVTKKTDGKGI
SCMNTTVSESPFKCDPDAAKAIVDALPPPCDSAHTVPTEVDKWFHHQKN
Download sequence
Identical sequences H0VQ28
XP_003473773.1.53824 ENSCPOP00000012630 ENSCPOP00000012630 10141.ENSCPOP00000012630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]