SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012877 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012877
Domain Number 1 Region: 290-396,468-547,587-754
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 9.42e-43
Family Quinoprotein alcohol dehydrogenase-like 0.038
Further Details:      
 
Domain Number 2 Region: 716-865
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000000636
Family Quinoprotein alcohol dehydrogenase-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012877   Gene: ENSCPOG00000014293   Transcript: ENSCPOT00000014435
Sequence length 886
Comment pep:known_by_projection scaffold:cavPor3:scaffold_44:15135023:15141978:1 gene:ENSCPOG00000014293 transcript:ENSCPOT00000014435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGASGPGAGAAPEALRVLSRRLQAQEEEMELVKAALAEALRLLRMRPPQAGSENKGTGD
SSAAPPGLPPPCTPSLVSRGTQTEPQEDSMPGHGPLGLSNGPPGPRTGSEVPGGALSEGG
SGSSGAGSPGPPGMLRPGQPPARVDTPRRNSSSSSPSERPRQKLSRKAASSANLLLRLGS
TESRGGKDPLSSPGGPGSRRSNYNLEGISVKMFLRGRPITMYIPSGIRSLEELPSGLPPE
TLSLDWVYYGYRGRDSRSNLFVLRSGEVVYFIACVVVLYRPGGGPGGPGDGGQRHYRGHT
DCVRCLAVHPDGIRVASGQTAGVDKDGKPLQPVVHIWDSETLLKLQEIGLGAFERGVGAL
AFSVADQGAFLCVVDDSNEHMLSVWDCGRGTKLAEIKSTNDSVLAVGFSPRDSSCIVTSG
KSHVHFWNWNGGTGASGNSALARKQGVFGKYKKPKFIPCFVFLPDGDILTGDSEGNILTW
GRSLSDSKTPGRGGAKETYGIVAQAHAHEGSIFALCLRRDGTVLSGGGRDRRLVQWGPGL
VALQEAEIPEHFGAVRAIAEGPGSELLVGTTRNALLRGDLAQGFSPVIQGHTDELWGLCT
HPAQNCFLTCGHDRQLCLWDGEGHALAWSLDLKETGLCADFHPSGSVVAVGLNTGRWLVL
DTETREIVSDVTDGNEQLSVVRYSPDGLYLAIGSHDNTIYIYSVSSDGAKSSRFGRCVGH
SSFITHLDWSKDGNFIMSNSGDYEILYWDVAGGCKLLRNRYESRDREWATYTCVLGFHVY
GVWPDGSDGTDINSLCRSHHERVVAVADDFCKVHLFQYPCARAKAPSRVFAGHGSHVTSV
RFTHDDAYLISLGGKDASIFQWRVLGTGPTTPSRTPSLSPASSLDV
Download sequence
Identical sequences ENSCPOP00000012877 ENSCPOP00000012877 10141.ENSCPOP00000012877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]