SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012933 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012933
Domain Number 1 Region: 114-158
Classification Level Classification E-value
Superfamily LysM domain 0.0000000183
Family LysM domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012933   Gene: ENSCPOG00000014357   Transcript: ENSCPOT00000014501
Sequence length 942
Comment pep:known_by_projection scaffold:cavPor3:scaffold_1:74537985:74632469:1 gene:ENSCPOG00000014357 transcript:ENSCPOT00000014501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTKEEKKERKQSYFARLKKKKQAKQNAETASSVAARSHPGKDDVNSVILEQDKCSIGGE
EEYVTDEKKKRKNNQLKEIKRTELKRYYSVDDNQNKTHDKKEKKMVVQKPHGTIAYTAGN
QDTLNSIALKFNVTPNKLVELNKLFTHTIVPGQVLFVPDANSLASSLRLSPSSGATVSPS
SSDAEYDKLPDADLARKALKPIERVLSSTSEEDEPGVVKFLKMNCRYFTDGKGVVGGVMI
VTPNNIMFDPHKSDPLVIENGCEEYGLICPMEEVVSIALYNDISHMKIKDALPSDLPQDL
CPLYRPGEWEDLASEKDINPFSKFKSISKERRQQSGERTGASEPVSSGSLEKSSEDTRTE
PQGSPMAGKFRKLKPIRARARGLPAVTKLRQELSEMHPTLESTAKENCLVGEDEDFEDLE
ELSSQSESRTDKRDALKECLSADPGDRKKTRWKVDAPAVESQVQPAPSVLATESDAELKG
TLDSETCEKQDTVPEVDKQSGFPESQVENSLDIHEDLDKVKLIEYYLPKNIEGPQPSENS
QTAELSDGKSTETVGIDITLSSTLLQAGDPPTESPKKPDEPPEKERGSLAMNVDTNIGEN
KIKEYLDSASEPALDSSCPGAQMDNKSEIQLWLLKRIQVPIEDILPSKEEKSKTPPMFLC
IKVGKPMRKSFATHTAAIVQQYGRRRKQPEYWFAVPRERVDHLYTFFVQWSPDVYGKDAK
EQGFVVVEKEELNMIDNFFSEPTTKSWEIITVEEAKRRKSACSEDEDEEDDGLPVLQPHS
ALLENMHVEQLARRLPARVQGYPWRLAYSTLEHGTSLKTLYRKSASLDSPVLLVIKDMDN
QIFGAYATHPFKFSDHYYGTGETFLYTFSPNFKVFKWSGENSYFINGDISSLELGGGGGR
FGLWLDADLYHGRSNSCSTFHNDILSKKEDFIVQDLEVWTFE
Download sequence
Identical sequences H0VQU4
ENSCPOP00000012933 ENSCPOP00000012933 XP_005008197.2.53824 10141.ENSCPOP00000012933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]