SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013140 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013140
Domain Number 1 Region: 9-229
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.96e-35
Family Eukaryotic proteases 0.00000599
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013140   Gene: ENSCPOG00000014585   Transcript: ENSCPOT00000014730
Sequence length 242
Comment pep:novel scaffold:cavPor3:scaffold_22:2087930:2089528:-1 gene:ENSCPOG00000014585 transcript:ENSCPOT00000014730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PHYVHVLSGLARIFNGEDTVPRSWPWQVSLQGKTGVLFCMGALITADWVFTATQFRVRHP
KMVVAVEFDQGSDEKAQQVLKITKVPGLDPNPTPFTISSDITQLKLATPACFSQTASTVC
LPIKDQRLPMGMLCATRGWGSTRHVPAPPPNRVQEAAIPLVSTHCRKFWTSLVTDMTFHT
RPVASPSALWGLLGSAHHGLLQEAAQDGARTLVGIVSWGSDNCSTSLPPGFPPWVQQILV
AH
Download sequence
Identical sequences ENSCPOP00000013140 ENSCPOP00000013140 10141.ENSCPOP00000013140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]