SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013352 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013352
Domain Number 1 Region: 148-391
Classification Level Classification E-value
Superfamily vWA-like 2.67e-80
Family Integrin A (or I) domain 0.000000326
Further Details:      
 
Domain Number 2 Region: 371-480
Classification Level Classification E-value
Superfamily Integrin domains 8.89e-24
Family Integrin domains 0.0032
Further Details:      
 
Domain Number 3 Region: 645-717
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000000129
Family Integrin beta tail domain 0.0081
Further Details:      
 
Domain Number 4 Region: 44-99
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000356
Family Plexin repeat 0.0026
Further Details:      
 
Domain Number 5 Region: 603-642
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000809
Family Integrin beta EGF-like domains 0.0076
Further Details:      
 
Domain Number 6 Region: 561-599
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000809
Family Integrin beta EGF-like domains 0.0086
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000013352
Domain Number - Region: 535-563
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0218
Family Integrin beta EGF-like domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013352   Gene: ENSCPOG00000014817   Transcript: ENSCPOT00000014962
Sequence length 799
Comment pep:known_by_projection scaffold:cavPor3:scaffold_9:46598348:46607242:1 gene:ENSCPOG00000014817 transcript:ENSCPOT00000014962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVWSVSLVFLLVLGKGESELDDKISPRGKATEWGDPDLSLPESCQPAPSCKECILSHPS
CAWCKQLNFTASGEAESRRCAPRKDLLARGCPAQELEEPRGWQEVLQDEPLSHGYRGEGA
TQLAPQRVRITLRPGEPHQLRVRFLRAAGYPVDLYYLMDLSYSMKDDLERVRQLGHALLV
QLQKVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPSRLEPCQSPFSFRHVLSLTGDAQ
AFEREVGRQNVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGRCHLDSNGLYSSSSEFDYPSVSQVAQALSAANIQPIFAVTSATLPIYQELS
QLIPKSAVGELSEDSSNVVQLIMDAYHSLSSTVILEHSSLPPGVNISYESYCGGTETKVE
AGVRGQCNHVRVNQTVDFWVTLQAKSCLQEPHYLRLRARGFSEELTVELHTLCDCNCSDT
QLQDLHMHCSGGQGQLQCGMCSCLPGRLGRLCECSEADLSSPDLESGCRGPNGTGPLCSG
KGRCQCGRCSCSGQSSGRLCECDDAGCERHEGKLCGGFGHCRCGVCHCEANRTGRACECS
GDMDKCISPVGGLCSGHGHCKCNRCQCLDGYYGAVCDQCPGCKTPCEKHRDCAECGAFGT
GPLAANCSMACAHANVTLALGPILDDGWCKEKTQDNQLFFFLIEDEAGGRVVLTVRPQEK
REDHTQAIVLGCVGGIVAVGLGLVLAYRLLVEIYDRREYSRFEKEQLQLNWKQDSNPLYK
SAITTTINPQFQRAESPVL
Download sequence
Identical sequences A0A286XN57
XP_003476077.1.53824 ENSCPOP00000013352 ENSCPOP00000013352 10141.ENSCPOP00000013352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]