SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013367 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013367
Domain Number 1 Region: 7-189
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 5.49e-48
Family Isochorismatase-like hydrolases 0.0000798
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013367   Gene: ENSCPOG00000014834   Transcript: ENSCPOT00000014979
Sequence length 202
Comment pep:known_by_projection scaffold:cavPor3:scaffold_70:40282:42505:1 gene:ENSCPOG00000014834 transcript:ENSCPOT00000014979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAARLGRILPGSSILFLCDMQEKFRRSIVYFPEIVSVAARMLRVAQLLEVPTVLTEQYP
QGLGPTVPELGAKGLQALSKTCFSMVPAVRQELDSRPQLQSVLLCGIEAQACILHTALDL
LDRGLQVHVVVDACSSRSQVDRLVALARMRQSGAFLSTSEGLILQLVSDAAHPQFKKIQD
IIKEPAPDSGLLGLFQGQNPLL
Download sequence
Identical sequences 10141.ENSCPOP00000013367 XP_003465592.1.53824 XP_013003176.1.53824 XP_013003177.1.53824 ENSCPOP00000013367 ENSCPOP00000013367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]