SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013471 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013471
Domain Number 1 Region: 263-766
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.02e-50
Family Quinoprotein alcohol dehydrogenase-like 0.021
Further Details:      
 
Domain Number 2 Region: 726-773,800-876
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000000000353
Family Quinoprotein alcohol dehydrogenase-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013471   Gene: ENSCPOG00000014948   Transcript: ENSCPOT00000015094
Sequence length 954
Comment pep:known_by_projection scaffold:cavPor3:scaffold_18:26599267:26747374:1 gene:ENSCPOG00000014948 transcript:ENSCPOT00000015094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGFAGSLDDSISAASTSDVQDRLSALELRVQQQEDEITVLKAALADVLRRLAISEDHVA
SVKKSVPTKGQPSLREAISMSCITNGSGANRKPAHTSSVSIARKETLSSAAKSGTEKKKE
KPQGQREKKEESHSNDHSPQTRASPSPQPSSQPLQIHRQTPESKNSAPTKSIKRLPTAEK
LHNSWENSDDSRNKLLKTPSTSKLLSKVTKNTDKHKDVLINQAKMSTREKNSQEGDYIKM
FMRGRPITMFIPSDVDNYDDIRTELPPEKLKLEWVYGYRGKDCRANVYLLPTGEIVYFIA
SVVVLFNYEERTQRHYLGHTDCVKCLAIHPDKIRIATGQIAGVDKDGRPLQPHVRVWDSV
SLSTQQIIGLGTFERGVGCLDFSKADSGVHLCVIDDSNEHMLTVWDWQKKSKAAEIKTTN
EVVLAVEFHPTDANTIITCGKSHVFFWTWSGNSLTRKQGIFGKYEKPKFVQCLAFLGNGD
VLTGDSGGGILIWSKTTVEPTPGKGPKGIYQISKQIKAHDGSVFTLCQLRNGLLLTGGGK
DRKIILWDHDLNPEREIEVPDQYGTIRAVAEGKADQFLVGTSRNFILRGTFNEGFQIEVQ
GHTDELWGLATHPFKDLLLTCAQDRQVCMWHSVEHRLEWTRLLDEPGHCAGFHPSGTVVA
IGTHSGRWFVLDAETRDLVSIHTDGNEQLSVMRYSVDGTFLAVGSHDNFIYLYVVSENGR
KYSRYGKCTGHSSYITHLDWSPDNKHIMSNSGDYEILYWDIENGCKLIRNRSDCKDIDWT
TYTCVLGFQVFGVWPEGSDGTDINALVRSHNRKVIAVADDFCKVHLFQYPCSKAKAPSHK
YSAHSSHVTNVSFTHNDSHLISTGGKDMSIIQWKLVEKLSLPQNEISADTTSAKALTSST
EGIVQPDTHAPAPSQSLNETAEDHSRSSSPPTLLENSLEQTAAAHEEHGEEQSE
Download sequence
Identical sequences ENSCPOP00000013471 ENSCPOP00000013471 10141.ENSCPOP00000013471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]