SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013528 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000013528
Domain Number - Region: 106-157
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.000167
Family VPS37 C-terminal domain-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013528   Gene: ENSCPOG00000015010   Transcript: ENSCPOT00000015157
Sequence length 285
Comment pep:known_by_projection scaffold:cavPor3:scaffold_115:698887:725981:1 gene:ENSCPOG00000015010 transcript:ENSCPOT00000015157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAAGEARFAGLSLVQLNELLEDEGQLTEMVQKMEETQTVQLSKEMTLASNRSLAEGNL
LYQPQLDTRKARLTQKYQELQVLFDAYQIKKTKLDKQSNSASLETLLALLQAEGAKIEED
TENMAEKFLDGELPLDGFIDVYQSKRKLAHMRRVKVEKLQEMVLKGQRLPQAPAPLPARA
PEPVPTASPPYPVLEPAVPPSVVPRRIPPPPPPVPAGRLATPFTAALGSGQALPYSALQC
PPLPPRVGLSPQQGFSAQLVSPYPPALPQRPPPRLPPHQPGFILQ
Download sequence
Identical sequences A0A286XJC6
10141.ENSCPOP00000013528 ENSCPOP00000013528 ENSCPOP00000013528 XP_003462960.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]