SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013587 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013587
Domain Number 1 Region: 1532-1646
Classification Level Classification E-value
Superfamily C-type lectin-like 2.05e-43
Family Noncollagenous (NC1) domain of collagen IV 0.00000307
Further Details:      
 
Domain Number 2 Region: 1426-1531
Classification Level Classification E-value
Superfamily C-type lectin-like 1.93e-42
Family Noncollagenous (NC1) domain of collagen IV 0.00000451
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013587   Gene: ENSCPOG00000015073   Transcript: ENSCPOT00000015220
Sequence length 1647
Comment pep:known_by_projection scaffold:cavPor3:scaffold_46:13048861:13132253:1 gene:ENSCPOG00000015073 transcript:ENSCPOT00000015220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRPGPIGIQGPTGREGFVGPTGLSGLKGEKGFPGPPGPYGTKGDKGPMGVPGFLGIDGIP
GYPGQPGPRGPPGLDGYNGTKGAVGFPGPDGYPGILGPPGPPGLKGSKGEPIFSHDNFIG
RKGNPGLPGLDGIMGPQGPPGTPGDKGLMGSPGLQGPPGPPGFPGPDGNTGLGFHGEKGV
KGDVGLPGPAGPPPSTGEQEFMGVPKGKKGSKGESGPPGPPGMTGPPGFQGHDKTKFGSI
GGKGEKGILGLPGPRGPMGSEGVPGPPGTKGKKGSPGISGFNGLPGIKGEKGASGLPGPD
VFTSADGAMISGYPGDPGMPGPPGIKGDEGIHGQRGLSGIPGLPALPGVPGVIGPQGLPG
LKGDQGNPGHTTIGGAGLPGRLGLLEGSDGSGSGPSPPSKTGTLNGTGTGFPGLRGEQGL
KGNPGRKGVKGDLGFCTCDGGVTNTGPRGEPGLPGPQGVRGFPGLKGTRGDPGSEGAQGP
AGSPGSFGPQGLPGVKGKKGEPTFSMESGMPGEKGDRGLQGFPGIKGAPGKDGISGLPGL
PGLQGDGGKGFPGEKGLPGLPGGKGHSGPTGPPGIGLPGLPGPQGPPGEKGIDGFPGQQG
LRGSPGITLPCIIPGSYGPSGLPGIPGLPGPKGVRGLPGTPGQPGSHGNKGEPGSSGLLH
LPELPGFSGPRGEKGLPGFPGLAGKDGLAGKAGSPGLPGSKGAPGDILAAENGASGAQGL
QGLPGDRGVPGDSGPPGPKGLHGQPGLLGPKGDQGIPGTPGQVGQPGPPGSSGLHGIKGK
SGLLGAPGLPGISGYPGKKGQKGEKGLPGSTRKRGLPGMKGLPGSLGLTGFLGSPGLPGV
TGFPGPPGPKAGDKGSIGLIGFPGLQGLPGFPGAIGLKGILGLAGKVGTSGPAGSAGEKG
DRGDPGPVGEPSPRPPMLSLWFKGDKGSQGSAGLDGFPGPKAGDKGEAGRPGSPGLPGAP
GLPSTIKGLNGMPGPPGSMGLLGSPGLKGSSGITGFPGMPGEHGSQGLAGVPGLPGASGL
PGSKGDQGHTLEISGSRGPKGQPGEPGIKGVKGKDGPVGDIGFPGNKGEDGKDGISGDVG
LPGSPGLPGTTGISGDPGFPGSSGHSGSLGPLGPSGLIGPKGFSGPPGLHGLNGLPGTKG
TRGTPGASITGVPGPAGLPGLKGEKGLPGTVTGAPGKSGPKGQKGGRGFPGLQGPAGPPG
AQGISLPSIIAGQPGQPGQQGLDGERGRPGKQGSPGPPGPSSDQGDPGDPGFPGIPGLQG
PKGDQGIPGFSGLPGELGLKGMKGEAGFMGTPGKVGPPGDPGLPGMKGKAGPRGSPGLQG
APGKTPVVEAIHVPPGPLGLPGINGIPGLSGDPGPQGPVGPQGSKGLPGIPGKDGLSGLP
GPPGALGDPGLPGLQGPPGFEGAPGKSGPSGSPGRPGHSVRVGYTLVKHSQSEQVPLCPI
GMNQLWVGYSLLFVEGQEKAHNQDLGFAGSCLPHFSTMPFIYCNINEVCHYARRNDKSYW
LSTTAPIPMMPVSQTQIPQYISRCSVCEAPSQAIAVHSQDITIPQCPLGWRSLWIGYSFL
MHTATGAEGGGQSLVSPGSCLEDFRATPFIECSGARGSCHYFANKYSFWLTTVEERQQFR
EESVSETLKAGQLHTRVSRCQVCMKNL
Download sequence
Identical sequences ENSCPOP00000013587 ENSCPOP00000013587 10141.ENSCPOP00000013587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]