SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013595 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013595
Domain Number 1 Region: 1533-1645
Classification Level Classification E-value
Superfamily C-type lectin-like 1.34e-46
Family Noncollagenous (NC1) domain of collagen IV 0.00000182
Further Details:      
 
Domain Number 2 Region: 1421-1530
Classification Level Classification E-value
Superfamily C-type lectin-like 4.71e-43
Family Noncollagenous (NC1) domain of collagen IV 0.00000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013595   Gene: ENSCPOG00000015081   Transcript: ENSCPOT00000015228
Sequence length 1646
Comment pep:known_by_projection scaffold:cavPor3:scaffold_46:12521429:12671929:-1 gene:ENSCPOG00000015081 transcript:ENSCPOT00000015228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CYGCSPGSKCDCSGVKGEKGERGFPGLEGHPGLPGFPGPEGPPGPRGQKGDDGIPGPPGP
KGIRGPPGLPGFPGTPGLPGMPGHDGAPGPQGIPGCNGTKGERGFPGSPGFPGLQGPPGT
PGIPGMKGEPGSIIVSLLPGPKGNPGYPGPPGTQGPAGPQGIPGPIGPPGPPGLLGPPGP
PGPPGPKGNMGLNFQGPKGEKGEQGLQGPPGPPGQISEQKRPIDVEFQKGDQGLPGVSHP
RQFSIILYVQGPPGGVKGEKGEQGEPGKRGKPGKDGENGQPGIPGLPGDTGYPGEPGKDG
EKGQKGDIGPPGPPGFVIPRPGTGITIGEKGNIGLPGLPGEKGERGFPGIQGPPGLPGLP
GAYKCPPTSQEGIRGNLIKRGNEERFGMQVSGVLTLDSTSKAKNLTVSPLKSNHNIAASC
TIIGGDGVTALCQHTLLPGDKGDTCFNCIGTGISGHPGRPGLPGVPGPPGSLGFPGQKGE
KGETGETGSKGLPGIPGAPGAPGLPGTKGEPGDVFTFPGMKGEKGELGAPGAPGLPGLPG
TPGQDGLPGLPGPKGEPGGIVFKGERGPPGNPGLPGLPGNMGPMGPVGFGPPGPVGEKGI
QGVAGNPGQPGMPGPKGDPGQTITQPGKPGLPGNRGRDGEVGLPGDPGLPGQPGVPGIPG
SKGEPGIPGIGLPGPPGPKGFPGVPGPPGVPGIPGRTGQEGPPGPPGFPGPKGEPGFGSG
LPGFKGTLGPKGDRGFPGLPGPPGHTGLDGLPGPKGDVGPSGQPGPIGPPGQPGIGVQGQ
PGKSGVNKGRVGQKCLHGIPGEKGDQGPPGFDVPGPPGERGSPGIPGAPGPMGPPGSPGL
PGKAGVPGFPGTKGEMGMMGPPGPQGPLGIPGRNGAPGFKGDNGLPGHPGLPGPPGEKGG
KGEPGLPGPPGPMDPNLLASKGEKGEPGLPGVPGVSGPKGYQGLPGDPGQPGLRQQCILT
RKESPKGDPGLPGQPGLIGPTGLKGNIGDMGFPGPQGVEGLPGPPGVPGQPGSPGLPGQK
GDKGDPGISGIGLPGVAGPKGEPGQPGIPGNPGIKGSMGVTGLPGLPGTPGAKGQPGLPG
FPGTPGLPGPKGISGPPGNPGLPGEPGPVGGAGHPGPPGPPGEKGTPGQDGIPGPAGQKG
EPGHPGFGIPGPPGLPGLSGQKGDGGLPGIPGNPGLPGPKGEPGFQGFPGVQGPPGPPGS
PGPALEGPKGNPGPQGPPGRPGLPGPEGPRGLPGNGGIKGERGNPGPPGPPGFPGSKGDQ
GSPGLLGNPGRPGLNGMKGDPGLPGVPGFPGLKGPIGVPGSTGPEGEPGLTGAPGPPGLP
GPSGQSIIIKGDAGPPGIPGQPGLKGPPGLSGPQGLPEGPVGPPGDPGRNGLPGFDGAGG
RKGDTGLPGQPEIGTRGLDGPPGPDGLQGPPGPPGTTSVAHGFLITRHSQTVDAPQCPQG
TVQISEGFSLLYVQGNKRAHGQDLGTSGSCLRRFSTMPFMFCNINNVCNFASRNDYSYWL
STPEPMPMNMEPLKGQSIKPFISRCVVCEAPAMVIAVHSQTIQIPHCPQGWDSLWIGYSF
MMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGLGTCNYYANSYSFWLATVDVLDMFS
KPQSETLKAGDLRTRISRCQVCMKRT
Download sequence
Identical sequences 10141.ENSCPOP00000013595 ENSCPOP00000013595 ENSCPOP00000013595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]