SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013678 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013678
Domain Number 1 Region: 22-279
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.03e-82
Family Carbonic anhydrase 0.00000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013678   Gene: ENSCPOG00000015172   Transcript: ENSCPOT00000015319
Sequence length 279
Comment pep:known_by_projection scaffold:cavPor3:scaffold_25:24402548:24415493:-1 gene:ENSCPOG00000015172 transcript:ENSCPOT00000015319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATLVTLVSLLLLGFQAQVRSEWTYSEGQLDEEHWALHYPACGGTRQSPINLQRRKVHFN
PALTPLELMGYEEGQAGQFPMTNNGHTVQITLPESMRLAGPEGTEHVAVQMHFHWGGDSF
EVSGSEHTVDGVRRVMEIHVVHYNSKYESYDIAKDAPDGLAVLAAFVEMEEDAENTYYSS
FISHLANIKYPGQSTMISGLPVLDMLPENHFEYYTYHGSLTTPPCTENVRWFVLQDSVKL
SRAQVWKIENSLLTHDNKTLHNGYRSVQPLHDRVVEASF
Download sequence
Identical sequences ENSCPOP00000013678 ENSCPOP00000013678 10141.ENSCPOP00000013678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]