SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013961 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013961
Domain Number 1 Region: 351-483,518-882
Classification Level Classification E-value
Superfamily ALDH-like 2.89e-108
Family ALDH-like 0.00000181
Further Details:      
 
Domain Number 2 Region: 1007-1429
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.09e-89
Family L-arabinose binding protein-like 0.0000437
Further Details:      
 
Domain Number 3 Region: 193-261
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000000141
Family Intermediate filament protein, coiled coil region 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013961   Gene: ENSCPOG00000015480   Transcript: ENSCPOT00000015632
Sequence length 1437
Comment pep:known_by_projection scaffold:cavPor3:scaffold_25:16197281:16256636:1 gene:ENSCPOG00000015480 transcript:ENSCPOT00000015632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FCRWEEELTKRMDLQTMVDTLQEAAQEAEAIQEEMNEKIERLKAELVVFKGLMSDPMTDL
DTKIQEKAMKVDMDICRRIDITAKLCDVAQQRNSEDVSKIFQVVPKKKERKVASDDDISE
QDGEVNRFSDDEVGSMNITDEMKRMFNQLRETFDFDDDCDSLTWEENEDTLLLWEDFTNC
NPTLDLQGEQEENLGNLIHETESFFKTRDKEYQETIGQIELELATAKSDMNRHLHEYMEM
CSMKRGLDVQMETCRRLIKGSADRNSPSPSSVASSDSGSTDEIQDELEREADVEPMKLSL
LHLGVTEVTTAMGALWTGSEMLLQPRVLRRVLLVRPWSGAGPRWKHTSSRQVANEPILAF
TQGTPEREALQKALKDLQGRTETIPCVVGDEEVWTSDVQYQVSPFNHGHKVAKFCYADKA
LLNKAIEAALAARKEWDLKPVADRAQIFLKAADLLSGPRRAEVLAKTMVGQTIFVPIVAW
LCAHRAEDASVPGGSSFAAEPNPVLQGKTVIQAEIDAAAELIDFFRFNAQFAVELEGEQP
ISLPPSTNRVVYRGLEGFVAAISPFNFTAIGGNLSGVPALMGNVVLWKPSDTAMLASYAI
YHILREAGLPPNIIQFVPADGPLFGDTVTSSEHLCGINFTGSVPTFKHLWKQVAQNLDRY
RTFPRLAGECGGKNFHFVHRSADVDSVVSGTLRSAFEYGGQKCSACSRLYVPSSLWPQIK
GRLLEEHSRIKVGDPTEDFGTFFSAVIDAKSFARIKKWLEHARSSPSLTILAGGKCDDSV
GYFVEPCIVESSDPQELIMKEEIFGPVLTVYVYPDDRYKETLQLVDSTTRYGLTGAVFAQ
DKDVVQEATKMLRNAAGNFFINDKSTGSVVGQQPFGGSRASVISPAFLLICHFAAMGLWI
RTLWHLFFPMQLLTGLAEPAENLDFFLPGDYLLGGLFTLHANAKGTSHLTILQVPSCEDN
GSGGSDVLVTWITHKGVVKLTAVVPILATGGLVMQVTVGMWSLWAYEMKVLGYNLMQAMR
FAVEEINNHSSLLPGVQLGYEIVDICYQTNNVQPVLYFLTQPDYFLPISKDYSYYIPRVV
AVIGPDNSESTITVANFLSLFLLPQITYSANSDQLRNKRLYPAMLRTMPSATHHIEAMVQ
LMLHFHWNWIVVLMSNDDYGRDNSQLLRDRLARTNDICVAFQEVLPTPQANQFLTAAELK
QLDSILLKLKQSTARVVVIFSPELVLHNFFHGALYWNVTDTVWIASESWSIDPVLHNLPG
LQSTGTFLGITIQAVTIPGFSEFRLRPTEATPERQPTKNSSRATCNQECDACLNVTKTFS
SILTLSGERVVYCVYSAVYAVAHALHNLLHCGRHHCTKKTVYPWQLLKEIRKVNFPLLSN
QIFFDEQGDVPMRLDVVQWQWLRKQNPFQSVAFYFPMQQALRMVGNISWHTEDNTVR
Download sequence
Identical sequences 10141.ENSCPOP00000013961 ENSCPOP00000013961 ENSCPOP00000013961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]