SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014010 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014010
Domain Number 1 Region: 44-280
Classification Level Classification E-value
Superfamily PLP-binding barrel 4.22e-59
Family Alanine racemase-like, N-terminal domain 0.000000184
Further Details:      
 
Domain Number 2 Region: 249-414
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 8.58e-30
Family Eukaryotic ODC-like 0.0000309
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014010   Gene: ENSCPOG00000015536   Transcript: ENSCPOT00000015688
Sequence length 448
Comment pep:known_by_projection scaffold:cavPor3:scaffold_0:4530843:4540762:1 gene:ENSCPOG00000015536 transcript:ENSCPOT00000015688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGFVDDANYSVGLLDEGTNLGNVIDNYVNEHTLTGKSAFFVGDLGKIVKKHSQWQSVAA
QIKPFYTVRSNSAPAVLEILAALGTGFACSSKNEMALVQELGVSPENIIYISPCKQVSHI
KYAAKIGVNIMTCDNEIELKKIARNHSNAKVLLHLATEDDRGGEEGSMKFGSTLKSCRHL
LECAKELDVQIVGVKFHVSRACKEPQVYVHALSDARCVFDMAGEFGFTMSMLDIGGGFTG
TAFQLEAVNRVIRPLLDVYFPEGSGIEIVSEPGSYYVSSAFTLAVNIIAKKVVDTEKFPA
GVEKTRSGEPAFVYYMNDGVYGSFASKLSEDLSALPEVHKKYKEGEPLFPSSLWGPSCDE
LDRVVESCLLPELDVGDWLLFTDMGADSFPEASVFKDVPRPAMYYMMSFSDWCELQDAGV
AADTVMKSFFFVPSCLQLSQEDGFATEA
Download sequence
Identical sequences ENSCPOP00000014010 ENSCPOP00000014010 10141.ENSCPOP00000014010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]