SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014132 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014132
Domain Number 1 Region: 6-436
Classification Level Classification E-value
Superfamily ALDH-like 6.28e-133
Family ALDH-like 0.0000000000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014132   Gene: ENSCPOG00000015670   Transcript: ENSCPOT00000015825
Sequence length 453
Comment pep:known_by_projection scaffold:cavPor3:scaffold_71:687909:693637:-1 gene:ENSCPOG00000015670 transcript:ENSCPOT00000015825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKFSEVVKQARAAFNSGRTRPLQFRIQQMEALRRMIKERGPDITRALAADLHKNEWTSY
YEEMVYVLEEIEHMIKKLPEWAADEPVEKTPQTQQDEPYIHSEPLGVVLIIGAWNYPFNL
IVQPMVGAIAAGNAVVLKPSELSENMASLLATIIPQYLDKDLYPVINGGVPETTELLKER
FDHILYTGSTAVGKIIMTAAAKHLTPVTLEMGGKSPCYVDKDCDLDVACRRIAWGKFMNS
GQTCVAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSRDYGRIINARHFQRVMGLIKG
QKVALGGTGEEATRYIAPTILMDVDPQSPVMQEEIFGPVMPIVCVHSLEEAIQFINQHEK
PLALYVFSSNDKVIKKMIAETSSGGVTANDVIVHLAVHSLPFGGVGHSGMGAYHGKKSFE
TFSHRRSCLVRSLQNDEAHKARYPPSPAKMPRH
Download sequence
Identical sequences H0VTW6
ENSCPOP00000014132 ENSCPOP00000014132 10141.ENSCPOP00000014132 XP_013003045.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]