SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014143 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014143
Domain Number 1 Region: 404-578,611-706
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 2.75e-57
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.00055
Further Details:      
 
Domain Number 2 Region: 1127-1183
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 2.12e-20
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00011
Further Details:      
 
Domain Number 3 Region: 707-750
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.000000000000523
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014143   Gene: ENSCPOG00000015684   Transcript: ENSCPOT00000015839
Sequence length 1183
Comment pep:novel scaffold:cavPor3:scaffold_18:32216676:32308719:1 gene:ENSCPOG00000015684 transcript:ENSCPOT00000015839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSTNPGNWVTFDDDSAFQSQKSRSFPLENQGVCRPNGLKLNLSGLKEFPSGSSSTSSTP
LSSPVVDFYFSPGPPSNSPLSTPTKDFPGFPGMPKAGTHVLYPIPESSSNSPLTPTGAGC
SSLPAKPTCLSQAFSPSDFFCTVPAPKGGLPDELCPQQAENTGVQGDTPQFQYFREDCAF
SSPFWKEESSASQVTFDTPGSRRMFSLKDKGMPVDQKSLNKCSLNYICEKLEHLQSAENQ
DPLGNVSTQCPYAEDSASSFVPHTLFRSQPKAGWSFMLRIPEKKNMMSSRQWGPIFLKVL
PGGILQMYYEKGLEKPFKELQLDPQCRLSEPKVENFSVAGKIHTVKIEHVSYTEKRKYHS
KTEVAHEPDIEQMLKLGSPEYRDFLDFLTTVEEELMKLPVVSKPKKNYEEQELSLEIVDN
FWGKVTKEDGKLVESAVITQICCLCFVNGNTECFLTLNDLQLQKRDGCGFEKDPEKKWID
ILDHHFHNCVNEQEFEQTRIIKFVPLDACRFELMRFRTLYPGDELPFSLKSVVVVQGAYV
ELQAFVNMAPSLQRPSHTGSLRCCDNIMIHFPVPSQWIKALWTMNLQRQKSLKAKMNRPL
CLGNLHEPESEPVIQVTVGSAKYESAYRAVVWKIERLPDKNSSPDHPHCLSYKLELGSDQ
EIPLDWYPFATVQFSMSDTCASRTEVRSLGVDSDMQPQKNIHQRACYNLQPKLYKSIIED
VIEGVRDLFTEEGIEEHVLNDLKQLWETKVLQSKATEDFFGNSIHSPLFTLQFPHTLHPT
LQSTVFYTASLVIPANRTVPGFTTAELGISNPSASFTFPGYPIYVPAGVTFQTASGHLYK
VNVPVMVAQTSGRPSVLQHPVQVFPQLGQPSVIQGSVPLLSPWCLPATPEKAPRMEAVFQ
QPTVLHSVPVDRKHLDSATSGVFVPPGREHGSLPEALLSQHGNSPCVQGPGVGFHSRGSP
VDSHVEPVLSVPARVTPHLRGGPVSACPQGTLLHPVTDAQPHLPRHCRYGGDSANRPGEA
AEPSSLPVSKENSNSRVDLTNQLTDDDINEIIQVDGTVDTSSNEEIGNIKDSEENEFLEI
IDAGELKVLEEEADSISNEDSTANSSDNEGSQADIVEEDPLNSGDDVSEQDVPDLFDTDN
VIVCQYDKIHRNKNKWKFYLKDGVMCFGGRDYVFAKAIGDAEW
Download sequence
Identical sequences ENSCPOP00000014143 ENSCPOP00000014143 10141.ENSCPOP00000014143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]