SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014205 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014205
Domain Number 1 Region: 3-136
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 9.68e-46
Family Molybdopterin synthase subunit MoaE 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014205   Gene: ENSCPOG00000015752   Transcript: ENSCPOT00000015907
Sequence length 140
Comment pep:known_by_projection scaffold:cavPor3:scaffold_29:8838925:8842512:1 gene:ENSCPOG00000015752 transcript:ENSCPOT00000015907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAEKLSVDEISQLVISPLCGAVSLFVGTTRNNFEGKKVISLEYEAYIPMAENEIRKICSD
IRQKWPVKHIAVFHRLGLVPVSEASIVIAVSSAHRAASLAAVSYAIDTLKAKVPIWKKEI
YEESSSSWKRNKECFWATSD
Download sequence
Identical sequences 10141.ENSCPOP00000014205 ENSCPOP00000014205 ENSCPOP00000014205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]