SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014345 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014345
Domain Number 1 Region: 11-129
Classification Level Classification E-value
Superfamily C-type lectin-like 5.6e-34
Family C-type lectin domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014345   Gene: ENSCPOG00000023856   Transcript: ENSCPOT00000027423
Sequence length 130
Comment pep:known_by_projection scaffold:cavPor3:scaffold_10:8983039:8985284:-1 gene:ENSCPOG00000023856 transcript:ENSCPOT00000027423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPPAASKGCIKCEAPCPEDWLLYGRKCYFFSEEPRDWNTGRQYCHTHEAALAVIQSQKEL
EFMFKFTRREPWIGLRRVGDEFHWVNGDPFDPHTFAISGPGECVFVEPTRLMSTECLMTR
PWVCSKMAYT
Download sequence
Identical sequences 10141.ENSCPOP00000014345 ENSCPOP00000014345 ENSCPOP00000014345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]