SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014346 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014346
Domain Number 1 Region: 387-651
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.2e-77
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 270-380
Classification Level Classification E-value
Superfamily Kringle-like 1.4e-32
Family Kringle modules 0.00038
Further Details:      
 
Domain Number 3 Region: 105-154
Classification Level Classification E-value
Superfamily Kringle-like 7.11e-17
Family Fibronectin type II module 0.0019
Further Details:      
 
Domain Number 4 Region: 166-206
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000028
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 5 Region: 203-243
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000733
Family Fibronectin type I module 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014346   Gene: ENSCPOG00000023599   Transcript: ENSCPOT00000022796
Sequence length 660
Comment pep:known_by_projection scaffold:cavPor3:scaffold_166:1425981:1430930:-1 gene:ENSCPOG00000023599 transcript:ENSCPOT00000022796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCWAQVPGPYPSPGLWLLWPLLLLLLLLPWETWPQAAKNYTEPPAPNATATLGALLIPV
TSATPKTPARGAVEAEVEAEGPRGGEHPNPDGVTPFSSVLRGQVLTETGQPCRFPFRYGG
RMLHTCTLEGSARRKWCATTHNYDRDRAWGYCVETTLPLQGTAVPDPCASGPCLNGGTCS
SAQDSTSYHCTCSPAFTGRDCGTEKCFDETRHEYLEPGDRWARVQQGHVEQCHCVGGQVQ
CEHAHHTACLNSLCLNGGTCHLITATGTSVCACPLGYAGRLCNIVPSQRCFVGNGTDYRG
VASTAASGLGCLAWNSDLLYQELHVDSVDAAALLGLGPHTFCRNPDKDERPWCYVVKDQA
LSWEYCRLAACESLTRVHLPSPEILAVIPTATLAPSPTCGRRHKKRTFLRPRIVGGSSSM
PGSHPWLAAIYIGDSFCAGSLIHTCWVVSAAHCFANSPPRDSVSVVLGQHFFNSTTDVTQ
TFTIEKYIPYPLYSVFNPGNHDLVLIRLKKKGDRCAVRSQFVQPICLPEPGSSFPAGHKC
QISGWGHMDEQVSGYASSLREALVPIVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQ
GDSGGPLACERNGVAYLYGIISWGDGCGRLNKPGVYTRVANYVNWISDRIRPAKRPLPPS
Download sequence
Identical sequences ENSCPOP00000014346 10141.ENSCPOP00000014346 XP_013013159.1.53824 ENSCPOP00000014346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]