SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014455 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014455
Domain Number 1 Region: 44-106
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.0000000353
Family Ribosomal protein L11, C-terminal domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014455   Gene: ENSCPOG00000026636   Transcript: ENSCPOT00000021095
Sequence length 133
Comment pep:novel scaffold:cavPor3:scaffold_14:37075820:37076309:1 gene:ENSCPOG00000026636 transcript:ENSCPOT00000021095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPRFDTNKIKVVYLRCTRGAVGTTFGSRDWLPVSGSKAQPEVVPSASALTIKTLKELPR
DRKQKNIKHRRNVTFDEIVNIAGQMQHQPLTRDLAGTIEEILGTASCGLQCGQLAPNDIL
DDINNDAMECTAS
Download sequence
Identical sequences ENSCPOP00000014455 ENSCPOP00000014455 10141.ENSCPOP00000014455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]