SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014519 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014519
Domain Number 1 Region: 1136-1307
Classification Level Classification E-value
Superfamily C-type lectin-like 1.91e-70
Family Endostatin 0.000000068
Further Details:      
 
Domain Number 2 Region: 41-236
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.32e-33
Family Laminin G-like module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014519   Gene: ENSCPOG00000020725   Transcript: ENSCPOT00000023475
Sequence length 1312
Comment pep:known_by_projection scaffold:cavPor3:scaffold_110:4225064:4251460:-1 gene:ENSCPOG00000020725 transcript:ENSCPOT00000023475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPFSPALQLHRDLRTHMLVHMDTSLLPLSDCPIPESTSQEVGLLQLLGEPLPQQITAISD
PEVGPAYIFGPDANNGQVARYHVPSPFFRDFSLLFHVRPDTGAAGMLFAITDASQAAVML
GVKLSGVQDQHQNISLLYMEPGASQTRTAASFRLPAFVGQWTRFALSVEGSSVALYVDCE
EFQRLPFTRSPRGLELEPGAGLFVGQAGGADPDKFQGAIAELWVRADPRVSPVRCQDEED
EDEDRASGDLGSGLEEHQELHREDVVVTQTPSLPPPPPVTTPPLARGGRDEREREEETAE
ARAKGSDGSHLSSLGKTLPGNEWDKRALSPGSSLETGGLKGQKGEPGAQGPPGPVGPQGP
VGPGMHSPDTHSVPGPQGPPGHPGPPGKDGAPGRDGEPGDPGEDGRPGDAGPQGFPGTPG
DVGPKGEKGDPGVGPRGPPGPQGPPGPPGPSFRHDKLTFVDMEGSGFSGDLETLRGPRGF
PGPPGPPGVPGLPGEPGRFGVNGSHVPGPPGLPGVSGRDGAPGFPGSPGPPGPPGREGPP
GRAGEKGTLGNAGAPGPKGSKGDPGPVGAPGENGFQGFAAGFDDMEGSGAPFWSTARGSA
ELQGPPGLPGLKGDPGVPGPPGDKGEVGADGTRGFPGLPGSEGPAGPMPLQGPKGEKGSP
GEKGDPGKDGVGQPGLPGPPGPPGPVVYVSEQDRALASVPGPEGRPGFAGFPDPGASPGP
GSEPGRLDGPGPKGEKGEPGGIFGPDSRALGPVQKGAKGEPGFRGPPGPYGRPGHKGEIG
FPGRPGRPGMNGLKGEKGEPGDATLGFGMRPAAGGHSRSGPAAPRRTPVYDSNAFVESSR
PGPPGAQGLPGPSGPKGDKGDVGQPGPPGKFPLDLFHLGAEMKGEKGERGDAGQKGERGA
PGASSGFFGSSVPGPPGPPGYPGIPGPKGESIRGPPGPPGPQGPPGIGYEGLPGPHTQSK
QWGWLGTALSPGCHRSPWRLGFSPCSYQPPGPPGAMGTSSGVRAWTTYEAMLEKVREVPE
GWLIFVAEDEELYVRVRNGVRKVLLEARMPLPPETDNEVAALQPPLVQLHEGGPYPRREH
SYSTARPWRADDILASPPRLPDPRPYPGVPHHHGAYVHLRPTSPTGSAAHSHQDFQPVLH
LVALNSPLPGGMRGIRGADFQCFQQARAVGLSGTFRAFLSSRLQDLYSIVRRADRGAVPI
VNLRDEVLSPSWEALFSGSQGQLKPGARIFSFDGRDVLRHPAWPQKNVWHGSDPSGRRLT
ESYCEAWRTEAVAATGQASSLLSGRLLEQSASSCRKAYIVLCIENSFMMPSK
Download sequence
Identical sequences ENSCPOP00000014519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]