SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014569 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014569
Domain Number 1 Region: 9-128
Classification Level Classification E-value
Superfamily Cgl1923-like 0.000000418
Family Cgl1923-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014569   Gene: ENSCPOG00000021060   Transcript: ENSCPOT00000022879
Sequence length 267
Comment pep:known_by_projection scaffold:cavPor3:scaffold_82:779787:791696:-1 gene:ENSCPOG00000021060 transcript:ENSCPOT00000022879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVPCGESDPDFSGCTLVLPAVSVGNVGQLAIDLIISTLNMSKIGYFYTDCLVPMVGNNP
YATAEENSTELSINTEVYSLPSRKLVALQLRSIFIKHTKYKSNSFCEKLLSWVKSSSFTR
VIVLSSSHSYQRNDLQLRSTPFRYLLTPCMQKSVENKIKSLNWQEMEKTPCIPEMSDSDY
CVRIPGGGITRALYEEGCSKEIYMAVLLKFVSEGDNVPDALGLAEYLNEWLQLIKPQSKD
PAPPTLPWKIPSSWKLLFGSGLPPALF
Download sequence
Identical sequences ENSCPOP00000014569 10141.ENSCPOP00000014569 ENSCPOP00000014569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]