SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014589 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014589
Domain Number 1 Region: 88-243
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 6.47e-85
Family Hedgehog (development protein), N-terminal signaling domain 0.0000000446
Further Details:      
 
Domain Number 2 Region: 248-398
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 2.04e-35
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014589   Gene: ENSCPOG00000023638   Transcript: ENSCPOT00000021574
Sequence length 464
Comment pep:known_by_projection scaffold:cavPor3:scaffold_32:4137570:4146429:-1 gene:ENSCPOG00000023638 transcript:ENSCPOT00000021574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKEPGSARGSERAGARQPSARQGAHAHRAHPLARRQTAGTAWKSPGSMGEMLLLARCLLV
VLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNS
ERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDE
DGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENS
VAAKSGGCFPGSATVHLEQGGTKLVKDLRPGDRVLAADDQGQLLYSDFLTFLDSDDGAKK
VFYVIETREPRERLLLTAAHLLFVAPPHNDSTAGEREVAAGVRPGQRVYVVAERDGDRRL
LPAAVHSVTLREEAAGAYAPLTAQGTILINRVLASCYAVIEEHSWAHRAFAPFRLAHALL
AALGPPAPASAEGIHWYSRLLYQIGTWLLDSEALHPLGMAVASS
Download sequence
Identical sequences ENSCPOP00000014589 10141.ENSCPOP00000014589 ENSCPOP00000014589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]