SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014651 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014651
Domain Number 1 Region: 1-84
Classification Level Classification E-value
Superfamily Heme oxygenase-like 2.25e-24
Family Eukaryotic type heme oxygenase 0.0000242
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014651   Gene: ENSCPOG00000023588   Transcript: ENSCPOT00000025364
Sequence length 84
Comment pep:known_by_projection scaffold:cavPor3:scaffold_140:2178537:2178788:1 gene:ENSCPOG00000023588 transcript:ENSCPOT00000025364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YAALEEEIERSRDSPSFAPVYFPEELHRREALEQDMAFWYGPQWRLAVPCSPATSRYVQR
LHEVGRAEPELLVAHAYTRYLGDL
Download sequence
Identical sequences ENSCPOP00000014651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]