SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014786 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014786
Domain Number 1 Region: 118-289
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 5.49e-51
Family NadC C-terminal domain-like 0.0000343
Further Details:      
 
Domain Number 2 Region: 14-117
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 2.04e-24
Family NadC N-terminal domain-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014786   Gene: ENSCPOG00000024975   Transcript: ENSCPOT00000022281
Sequence length 293
Comment pep:novel scaffold:cavPor3:scaffold_4:45294404:45310833:-1 gene:ENSCPOG00000024975 transcript:ENSCPOT00000022281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQVTMDTEGLSLLLPPTTLAALADSWLQEDCPGLNFAALATGAVPSQAALWAKSPGVLAG
RPFFDAIFAQLDCQVSWFLPEGSRLVPVVKVAEVRGPAHHLLLGERVALNMLARCSGIAS
AAATAVELTKAAGWAGRVAGTRKTTPGFRLVEKYGLLAGGAACHRYDLGGLVMVKDNHIV
AAGSVDKAVRGARLAAGFELKVEVECGSLHEAVQAAHAGADLVMLDNFKPEELHPTAAAL
KAQFPQVAVEASGGITLNNLPQFCGPHVDVISLGMLTQAAPALDFSLKLFAEE
Download sequence
Identical sequences ENSCPOP00000014786 10141.ENSCPOP00000014786 ENSCPOP00000014786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]