SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015045 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015045
Domain Number 1 Region: 97-151
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000327
Family VPS37 C-terminal domain-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015045   Gene: ENSCPOG00000021538   Transcript: ENSCPOT00000027213
Sequence length 352
Comment pep:known_by_projection scaffold:cavPor3:scaffold_65:9329695:9335242:-1 gene:ENSCPOG00000021538 transcript:ENSCPOT00000027213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLKDKTLQELEEMQSDPEAIGRLALESPEVQDLQLEREMALATNRSLAERNLEFQTPL
EISRSNLSDKYQELRRLVERCQEQKARLEKFSSALQPGTLLDLLQIEGMKIEEESEAMAE
RFLEGEVPLERFLEDFSAMRTLSHLRRVRVEKLQDVVRRPRVPQEPAGDTPPPRPPVPPR
PTVQAVPPVAEEPPPQVQPPPSTTPPYPLPYSPIPSLPVGPTAQGALPPAPFPVVAQPSA
YGAPPGPRPGVAMGYAWSPVRGVPPQQSYPTPPTSTSGPGYPLAGGRVPSPGYPQQSPFL
PMAGKPPYPTQAPLPGFWRGQPLPGAPGIPKDSPGGVPSLWSPESPGPWRRK
Download sequence
Identical sequences 10141.ENSCPOP00000015045 ENSCPOP00000015045 ENSCPOP00000015045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]