SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015284 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015284
Domain Number 1 Region: 119-233
Classification Level Classification E-value
Superfamily C-type lectin-like 9.8e-26
Family C-type lectin domain 0.0000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015284   Gene: ENSCPOG00000022081   Transcript: ENSCPOT00000024819
Sequence length 234
Comment pep:known scaffold:cavPor3:scaffold_86:3051532:3053379:1 gene:ENSCPOG00000022081 transcript:ENSCPOT00000024819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLLLLALLVGAVSTRHLKVDTSSLQSLQGEESLAQDGETAEGATREAASGVLMPLREE
VEEEMEGGSGSEDDPEEEEEEKEMESSSELDMGPEDVQCPKEEDIVKFEGSPGCKICRYV
VLSVPKTFKQAQSVCQRCFRGNLASIHSYNINLQVQRSSRILNVAQVWIGGQLRGKGHHK
HFHWVDGTLWNFWYWAAGQPWRGNNSGRCVTLCARGGHWRRSHCGVRRAFSCSY
Download sequence
Identical sequences H0VX55
10141.ENSCPOP00000015284 ENSCPOP00000015284 ENSCPOP00000015284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]