SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015333 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000015333
Domain Number - Region: 509-774
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000504
Family Rhodopsin-like 0.029
Further Details:      
 
Domain Number - Region: 35-64
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0241
Family C-type lectin domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015333   Gene: ENSCPOG00000027184   Transcript: ENSCPOT00000023450
Sequence length 817
Comment pep:known_by_projection scaffold:cavPor3:scaffold_27:9553342:9571685:-1 gene:ENSCPOG00000027184 transcript:ENSCPOT00000023450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSGASLAPPLTPQQSQGFLGPQVDLVAPGEVVETTDSVCKFPGQRLSWWQAQESCEQRFG
HLALGPPDGILAPPLSDSVWVGQRDASMQRLPQRREWGSEMGAYSDSPLGKAPKRNTSPY
LPALLRRMERHFTFPKSDPVHLYAMLPDQLPMPSLGSVTTGRSVRAPPTPRGAGCCLDPA
LAPLVPSEECPTWNPGLGTAGSELCVQARLFLCCYRKEIYEQLRDIQLWPGQDVISRVNA
LAEDTVLLPDPLSEAPAPLSLDKACSFLGILESVLAPEPELGPAALLAVVHFLKRVSALG
AREPQPLAGPWEQLARGVLSVTSLVLEERLAGTWLSISKVVGGPMALLATVQPLASLLST
TLSPEQPRIHIQYRHMGLSGVTAIHSWFSSSVFQRTLGAPSLKPQFPASPEEASRMQRFL
STQVGSAVLSSELQDAAGPVSTAVTFHLRHQAQQLKLFFPSPPSPETGGSWATTSCSVLA
LHRDSTACFCNHSTSFAILLQVYDVQRGPEEESLLRTLSFVGCGVSFCALATTFLLFLVA
RVPKSERTTVHKNLTFSLASAEGLLMASEWAKTSQVACVAVTAAMHLLFLAAFSWMLVEG
LLLWSKVVAVSMRPGPRMWLYYTAGWGSPTVIVAVTLVTSPGDYVASGHCWLNVHTDAIW
AFAGPVLFVLAANTCILFRVVTVTVSSARRRARMLSPQPGLQQQLGIQMWATVKPVLVLL
PVLGLTWLVGVLVHLSPAWAYAAVGLNSLQGPYIFLVYAACNAEVRNALQRVTEKKAALA
APRGGPDAHARAFQTRSQEGPTAWSPPRRHLALRGPA
Download sequence
Identical sequences ENSCPOP00000015333 ENSCPOP00000015333 10141.ENSCPOP00000015333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]