SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015503 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015503
Domain Number 1 Region: 376-549,578-639
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.13e-44
Family Voltage-gated potassium channels 0.0019
Further Details:      
 
Domain Number 2 Region: 643-828
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.03e-44
Family cAMP-binding domain 0.00047
Further Details:      
 
Domain Number 3 Region: 12-101
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.66e-21
Family Flavin-binding PAS domain 0.00000483
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015503   Gene: ENSCPOG00000022750   Transcript: ENSCPOT00000027897
Sequence length 1132
Comment pep:known scaffold:cavPor3:scaffold_32:682122:707960:-1 gene:ENSCPOG00000022750 transcript:ENSCPOT00000027897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRAAAQIAQAL
LGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEKDMVGSPARDTN
HRGPPTSWLTPGRAKTFRLKLPALLALTTRESSSVRPGGTGGSGAPGAVVVDVDLTPAAP
SSESLALDEVSALDNHVAGPAEERRALVAPGSPPSSVPGPPHTSPRAHSLNPDASGSSCS
LARTRSRESCASVRRASSADDIEAMRAGALPPPPRHASTGAMHPLRSGLLNSTSDSDLVR
YRTISKIPQITLNFVDLKGDPFLASPTSDREIIAPKIKERTHNVTEKVTQVLSLGADVLP
EYKLQAPRIHRWTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLKEPEEDAQTADCG
YACQPLAVVDLIVDIMFIVDILINFRTTYVNANEEVVSHPGRIAVHYFKGWFLIDMVAAI
PFDLLIFGSGSEELIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLAC
IWYAIGNMEQPDMNSRIGWLHNLGDQIGKPYNSSGLGGPSIKDKYVTALYFTFSSLTSVG
FGNVSPNTNSEKIFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVREFIRF
HQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLNRSLLQHCKPFRGA
TKGCLRALAMKFKTTHAPPGDTLVHAGDLLTALYFISRGSIEILRGDVVVAILGKNDIFG
EPLNLYARPGKSNGDVRALTYCDLHKIHRDDLLEVLDMYPEFSDHFWSSLEITFNLRDTN
MIPGSPGSTELEGGFNRQRRRKLSFRRRTDKDPEQPGEVPALGPARVGAGPSSWGRPGTP
WGDSPSSGPSSPESSEDEGQGRSSSPLRLVPFSSPRPPGEPRGAETLTEDGDKSDTCNPL
SGAFSGVSNIFSFWGDSRGRQYQELPRCPAPAPSLLNIPLSSPGRRPRGDVESRLDALQR
QLNRLETRLSADMATVLQLLQRQMTLVPPAYSAVTTPGPGPASTSPLLPISPIPTLTLDS
LSQVSQFVAFEELPPGAPELPQDGPTRRLSLPGQLGALTSQPLHRHGSDPGS
Download sequence
Identical sequences ENSCPOP00000015503 ENSCPOP00000015503 10141.ENSCPOP00000015503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]