SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015530 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015530
Domain Number 1 Region: 34-220
Classification Level Classification E-value
Superfamily HAD-like 1.4e-43
Family 5'(3')-deoxyribonucleotidase (dNT-2) 0.0000000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015530   Gene: ENSCPOG00000022552   Transcript: ENSCPOT00000026875
Sequence length 223
Comment pep:known_by_projection scaffold:cavPor3:scaffold_65:1073191:1117985:1 gene:ENSCPOG00000022552 transcript:ENSCPOT00000026875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVSLLGGCHVSRPAPAARRGPGSGAHGRYPRGPWLLVDMDGVPGGLLKKFRARFPDLPFV
ALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKQMANLQKQTDV
FICTSPIKMFKYCPYEKYAWVEKHFGPDFLEQIVLTRDKTVVSADLLIDDRLDIIAGAEP
HPSWEHVLFTSCHNQHVWLPPSRRRLHSWADDWMAILDSKRTR
Download sequence
Identical sequences 10141.ENSCPOP00000015530 ENSCPOP00000015530 ENSCPOP00000015530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]