SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015546 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015546
Domain Number 1 Region: 30-204
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase-like 4.32e-46
Family Peptidyl-tRNA hydrolase-like 0.0000706
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015546   Gene: ENSCPOG00000023968   Transcript: ENSCPOT00000022490
Sequence length 214
Comment pep:known_by_projection scaffold:cavPor3:scaffold_27:6843011:6844603:1 gene:ENSCPOG00000023968 transcript:ENSCPOT00000022490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSSVLLAGLWPSWAMSRRVLESGFSGKRWLVAGLGNPGLPSTRHSVGMAVLGQLAQRL
GVAESWVRDPRCAADLALAPLGDAQLVLLRPRRFMNANGRSVARAAELFGLTAEEIYLVH
DELDKPLGKLALKLGGSARGHNGVRSCISCLNSSAMPRLLVGIGRPAHRSAVEAYVLGCF
FPEEQELLPSLLDGATDLLLAHIRARSQEPSPGS
Download sequence
Identical sequences H0VXW5
ENSCPOP00000015546 XP_003470674.1.53824 10141.ENSCPOP00000015546 ENSCPOP00000015546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]