SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015957 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015957
Domain Number 1 Region: 23-164
Classification Level Classification E-value
Superfamily C-type lectin-like 9.79e-25
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 2 Region: 233-352
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000455
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015957   Gene: ENSCPOG00000023828   Transcript: ENSCPOT00000021350
Sequence length 486
Comment pep:known_by_projection scaffold:cavPor3:scaffold_42:6944852:6946351:-1 gene:ENSCPOG00000023828 transcript:ENSCPOT00000021350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLRLLLAWAAAVPTLGQASWPTEPHATCGPNSCYVLYPESRTFLEAWRACRELGGNLAT
PRTPEEARRVDSLLGAGPKDKLLWIGLQRQARQCQLQRPLRGFTWTTGDQDTAFTNWAQQ
AMGGSCMAQRCAALEASYAHRWHEGSCTLPIDGYLCQFGFEGACPALPDEAGQASPTVYT
TPFHLVSTEFEWLPFGSVAAVQCQFGRGASLLCVKQPEGGVGWSQAGPLCPGMSCGPDNG
GCEHECMEDMNGQVSCHCTEGFRLAADGHSCEDPCAQAPCEHHCEPGGPQGYSCHCLLGF
RPAEEEPHRCVDIDECQIAGVCQQMCVNYAGGFECYCSEGLELQEDGSNCIPTGAMGAPA
SRDLGDESDKGEEEEEKAERWRRWWKMTGVLSRDFGLSYRPSFPGERELRRPHLKPTWPA
QPNAPRVPYHSSVISNTQPVVVSATRPTLLSVRQTPVISATHPPLNPAHRVPVISALRPT
LPSAHQ
Download sequence
Identical sequences ENSCPOP00000015957 10141.ENSCPOP00000015957 ENSCPOP00000015957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]