SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016025 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016025
Domain Number 1 Region: 180-282
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.19e-19
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.027
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000016025
Domain Number - Region: 47-124
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.074
Family BphP N-terminal domain-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016025   Gene: ENSCPOG00000022169   Transcript: ENSCPOT00000021986
Sequence length 1079
Comment pep:known_by_projection scaffold:cavPor3:scaffold_25:25185931:25223637:-1 gene:ENSCPOG00000022169 transcript:ENSCPOT00000021986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ANSEFFQILGGHELPLADATVYSPKELAAVAAELTCKNTDTFVAVFSFLSGRLVHVSEQS
TSILKCKKDFLESSHFVDLLAPQDVRVFYTHTARAHLPFWNNWTQRASQYESAPVKSFFC
RIHGDSGHKRCYSPFRIVPLVHVHSPALSESEPCCLALVEKIHSGYEVAPQIPMDERIFT
TTHTPGCVFLEVDERAVPLLGYLPQDLIGTSVLTYLHPEDRPVMVAIHQKVLKYAGHPPF
EHSPVRFRAQDGDFIILDSSWSSFVNPWSWKVSFIIGRHKVRTRPLNEDVFATRISKMNN
NDRDITELQEQIHKLLLQPVHGRSSSSYGSLGSSRSQEQLLSTASSSKSSGHHAEKGTRR
GPTTLQQVYARVSKMKNLGQQLCTEPTTRSPAEPTKGTLTELAGGGQCYAREALSSSQRL
SHGVTYTESCAGLRKGQRSPSYQQINCIHSVIRYLESCSAPDLKRKYVSRRNTASSSSEE
DRPLHSAHSAQALQAAAQTPAIPAPEVPAGAPASGAARTLTLSTAALSVGPCSCCSTLVH
SPRVESAEDASLACGPGGALGTQPAALASEGLRCTGLSQAALLAHTQKEGQDYVARFRER
LLSSPCSCCLQQESGSTAESCRVQGAAASRHSRPAGCRKGRHKRKKLPAPPGCCSSGSSV
CPHHKGLLYRAQPWGPAAAPAPQAPGLALPTTTVLLPGQDTRLLPPLPVPAMTSLGTEDA
AAWGAAPAGLPTAPWPSSGLHAPPAFPAPYSDTSMAILLHAPPICLPWSLPFSPHPRSGA
AGASEMPPAAPAVAPNLEPPPSIDSQGREDDKWETHSEEPPCLNSRSSSPLQLNLLQEEV
PGLWLSPAPARRDLHPKAEHCVRGSRGRPDLSRTSVPKVSPSGTGSAASEGAYPPPRRVC
DPGRVSCPGPGLPQAVGPSKVTAARITVGPGQRVQSVRMSGPLGQSSLRQASSTSRSCGL
AGSSGSSVPLTRSDCSSELSEDKRQSPEGQQEEARGCVPDDSIWRVIEWMPEHVLMTYQV
PARVKEVVLREDLERLESMRAQQPQFSPGQKEELAKVRPWIQGQSVLQETRISVSRVTC
Download sequence
Identical sequences ENSCPOP00000016025 10141.ENSCPOP00000016025 ENSCPOP00000016025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]