SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016079 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016079
Domain Number 1 Region: 1-178
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.49e-39
Family Voltage-gated potassium channels 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016079   Gene: ENSCPOG00000025337   Transcript: ENSCPOT00000019532
Sequence length 234
Comment pep:known_by_projection scaffold:cavPor3:scaffold_105:954676:956341:-1 gene:ENSCPOG00000025337 transcript:ENSCPOT00000019532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLLRSLQAESKCAFLRTPLNIIDILAILPFYVSLLVGLAAGPAGSKLLERAGLVLRLLRA
LRVLYVMRLARHSLGLRSLGLTVRRCAREFGLLLLFLCVAMALFAPLVHLAERELGARRD
FSSVPASYWWAVISMTTVGYGDMVPRSLPGQVVALSSILSGILLMAFPVTSIFHTFSRSY
SELKEQQQRAASPEPALGEDSTREDSTHSATPTEDSSPDAERADSARVIPHFGP
Download sequence
Identical sequences ENSCPOP00000016079 10141.ENSCPOP00000016079 ENSCPOP00000016079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]