SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016272 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000016272
Domain Number - Region: 26-71
Classification Level Classification E-value
Superfamily Tropomyosin 0.0248
Family Tropomyosin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016272   Gene: ENSCPOG00000025423   Transcript: ENSCPOT00000027937
Sequence length 110
Comment pep:known_by_projection scaffold:cavPor3:scaffold_8:56300975:56316605:1 gene:ENSCPOG00000025423 transcript:ENSCPOT00000027937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLQEELKRLQNPLEQVNAGKYLLENHQLAMDMENNIEKYPLNLQPLESKVKIIQRAWREY
LQRHDPLEKRSPSPPSVSSDKLSSSVSMNTFSDSSTPVSVVTPLSRPDLP
Download sequence
Identical sequences ENSCPOP00000016272 ENSCPOP00000016272 10141.ENSCPOP00000016272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]