SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016382 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016382
Domain Number 1 Region: 9-132
Classification Level Classification E-value
Superfamily DNA clamp 5.93e-16
Family DNA polymerase processivity factor 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016382   Gene: ENSCPOG00000021299   Transcript: ENSCPOT00000026722
Sequence length 328
Comment pep:known_by_projection scaffold:cavPor3:scaffold_115:2149744:2178690:1 gene:ENSCPOG00000021299 transcript:ENSCPOT00000026722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKCGMSGSQVKVFGKAIQALSRVSEELWLDPSEKGLALRSINSSSSAYGYVLFSSVFFE
HYQWSTLENVNDNDRSLYLNCKLGMKSILPIFRCLNSFERNVEKCTIFTTSDKCKVVIQF
FCRYGIKKTHTVCFQESRPVQVNFEKNMCCNTLMIQPRLLAEAMVLFSSNQEEVTLAVSS
LNLCLKSSRGESAGLTNSVYSEMIIGPDEFDLFQVGLDTEITFCCKELKGMLTFSEATHV
PVSIHFDFPGKPVAVSIVDMLLEANFILSTLADDPGGAHSPPLLCLSQARRRSHRRRSDS
KAGVGGAAQAPECISRKAAPKRLCPPGT
Download sequence
Identical sequences ENSCPOP00000016382 10141.ENSCPOP00000016382 ENSCPOP00000016382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]