SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016416 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016416
Domain Number 1 Region: 76-211
Classification Level Classification E-value
Superfamily C-type lectin-like 4.98e-36
Family C-type lectin domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016416   Gene: ENSCPOG00000025365   Transcript: ENSCPOT00000028063
Sequence length 220
Comment pep:known_by_projection scaffold:cavPor3:scaffold_28:740555:747242:-1 gene:ENSCPOG00000025365 transcript:ENSCPOT00000028063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLVEPQSKMQGYQHSQMIPWVVAVVLISLLSACFIASCLVTHHKFLQCRRETKILPEYH
KKLICTREASGQKGTVRGGTWTCCPVGWRVFQSNCYFPFHDNKTWADSEKNCSGIGAHLA
SIVSEAEQNFTTKILKELFSYFIGLKSENGRGQWHWVDQTPFNPHKAHSERKNLNNKHKE
DCAVLVNDQNIWGWNDFPCNVKTSRICKIPGTVLKWHQCV
Download sequence
Identical sequences 10141.ENSCPOP00000016416 ENSCPOP00000016416 ENSCPOP00000016416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]