SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016514 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016514
Domain Number 1 Region: 41-185
Classification Level Classification E-value
Superfamily C-type lectin-like 9.62e-41
Family C-type lectin domain 0.0000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016514   Gene: ENSCPOG00000026613   Transcript: ENSCPOT00000026239
Sequence length 186
Comment pep:novel scaffold:cavPor3:scaffold_42:15091334:15093508:1 gene:ENSCPOG00000026613 transcript:ENSCPOT00000026239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLLILSLTICFLLLVTMLVQVSRIPKSPQVEAQDHEENLSLQQLSQINASLAHLCRPCP
WNWEPFQGSCYLFSRTLGSWDSSVSCCQAMGALVIINSIAEQRFLSYWDIRKSHVMWIGL
SDHNKEGSWHWVDNTLLQLSVHSFWKDGEPNNDGNQGCVQLAENTWSDNRCTAQNFWICE
KPLTPC
Download sequence
Identical sequences 10141.ENSCPOP00000016514 ENSCPOP00000016514 ENSCPOP00000016514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]