SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016556 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016556
Domain Number 1 Region: 67-193
Classification Level Classification E-value
Superfamily Lysozyme-like 8.89e-49
Family C-type lysozyme 0.0000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016556   Gene: ENSCPOG00000027605   Transcript: ENSCPOT00000021844
Sequence length 194
Comment pep:known_by_projection scaffold:cavPor3:scaffold_32:13840901:13846589:-1 gene:ENSCPOG00000027605 transcript:ENSCPOT00000021844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSGRPGPVSCLPSRSSALSLGIWGSTSAIHMETRRSWALRSRLCSPVMTLLVFAFLLSCL
LNSNEAKVYSRCELARVLRDFGLDGYRGYSLADWVCLAYFTSGFNTGAVDHEADGSTNNG
IFQINSRRWCKNLTPNSHNQCRVYCSDLLSPDLKDTVVCAMKIAQEPQGLGYWETWRRHC
QGKDLSDWVDGCDF
Download sequence
Identical sequences H0W0R8
10141.ENSCPOP00000016556 ENSCPOP00000016556 ENSCPOP00000016556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]