SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016635 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016635
Domain Number 1 Region: 300-562
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.16e-85
Family Eukaryotic proteases 0.00000000542
Further Details:      
 
Domain Number 2 Region: 106-212
Classification Level Classification E-value
Superfamily Kringle-like 2.13e-32
Family Kringle modules 0.00014
Further Details:      
 
Domain Number 3 Region: 215-303
Classification Level Classification E-value
Superfamily Kringle-like 1.88e-30
Family Kringle modules 0.0000223
Further Details:      
 
Domain Number 4 Region: 37-85
Classification Level Classification E-value
Superfamily FnI-like domain 3.35e-19
Family Fibronectin type I module 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016635   Gene: ENSCPOG00000026062   Transcript: ENSCPOT00000024081
Sequence length 563
Comment pep:known_by_projection scaffold:cavPor3:scaffold_80:795832:806339:1 gene:ENSCPOG00000026062 transcript:ENSCPOT00000024081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSRRMRRAFLYVLLLCGAVSTLPSQKTRVRFRRGARSYRVTCRDEKTQTTYQLHESWLRP
LLRANRVEFCWCNGGRPQCHSVPVKGCSEPRCFNGGTCWQPLYFSDFVCQCPKGFMGKRC
EIDTRVTCYKDQGISYRGTWSTAESGAECVNWNSSVLVLKPYSARRPGAIRLGLGNHNYC
RNPDKDSKPWCYVFKAGKYIPEFCSTPACSRGKQEDCYFGNGSAYRGTQSLTTSGASCLP
WDSMILRGRGYTAWRFNSQALGLGKHNFCRNPDGDAKPWCHVLKDRKLTWEYCDLPQCST
CGLRQYQQPQFRISGGLYADIASHPWQAAILIWDRRSQEERFLCGGVLISSCWVLSAAHC
FLERSSHELQVVLGRTYREIPGEEEQKFEVEKYILHKDFDEDTYDNDIALLHLKSASQHC
AQESSVVRTVCLPDAALQLPDWTECELSGYGKHEASSPFYSERLKEAHVRLYPPSRCTSQ
HLFNKTITNNMLCAGDTRSGGNQANLHDACQGDSGGPLVCLKDGRMMLVGIISWGIGCGQ
KDVPGVYTKVTNYLSWIQENMGL
Download sequence
Identical sequences ENSCPOP00000016635 10141.ENSCPOP00000016635 ENSCPOP00000016635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]