SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016667 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016667
Domain Number 1 Region: 111-245
Classification Level Classification E-value
Superfamily C-type lectin-like 1.12e-23
Family C-type lectin domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016667   Gene: ENSCPOG00000026823   Transcript: ENSCPOT00000020111
Sequence length 246
Comment pep:novel scaffold:cavPor3:scaffold_28:4105243:4110138:1 gene:ENSCPOG00000026823 transcript:ENSCPOT00000020111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKNRPNEGIVQEQEITYTDVKISKNQQKQRVFKREQNPVLSSEQEVNYVEMKFHRTSHN
RAQLGGQKRKGAPSTAWKRIAGILAFVCIVLITVIGTLLSNLFSSREDQSRNFTLFPTLS
SKSNGCSSGLCSHNWIGYGNSYYHFSSEAKTWEESQSTCAKLNSHLLKVDSEEDLLNFLM
IEMTGWIAFNINENNGSWVGKNVFQLNDNLLFVLEGKNQSCAYVNGKSLYTEDCSSRKLF
ICEFNI
Download sequence
Identical sequences ENSCPOP00000016667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]