SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016677 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016677
Domain Number 1 Region: 35-186
Classification Level Classification E-value
Superfamily C-type lectin-like 8.1e-20
Family C-type lectin domain 0.0039
Further Details:      
 
Domain Number 2 Region: 385-434
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000452
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 3 Region: 258-386
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000549
Family Growth factor receptor domain 0.0093
Further Details:      
 
Domain Number 4 Region: 427-471
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000182
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016677   Gene: ENSCPOG00000010252   Transcript: ENSCPOT00000020934
Sequence length 630
Comment pep:known_by_projection scaffold:cavPor3:scaffold_8:5122662:5124829:1 gene:ENSCPOG00000010252 transcript:ENSCPOT00000020934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GMASCWDLLLLLLLVQPWVGAAASTAEATTEAVVCAGTACYTAHWGRLSPADAQGFCRQN
GGNLATVKSEEEARLTQRALAQLLRSRAPLAARMGKFWVGLQREKGKCLDPELPLKGFSW
VGGGEDTEYTNWQKDLKSSCLSQRCVALTLDLSEIPQPDRLPKWSDGPCGSSSNPGSNTE
GFVCKFSFKGMCRPLALGGPGQVNYSTPFRATTSSLDAVPFGSLANVACEVGAELQSYEL
LCREKATQVFDWGITGPVCVNPELGCSFNNGGCEQDCFEGGAGSFRCGCRPGFRLRDDLV
SCASRNPCSSNPCKGEATCILGSQGDSYTCHCSPGYQLDASQLKCVDVDECQDAPCAQDC
VNTDGSFRCECWVGYTAGGPGEEACVDVDECALDPAPCTQHCTNTPGSFHCSCQPGYAPS
GENATQCEDEDECAGPTGNPCQGPCSNVPGSFHCGCLAGWTLGPDGFSCIPDPASSVSLA
GLLPEDEPARKWPQDVPASSRGSDSFSTGILTTGRASLPSEVPTPSAYPKAPTPNGHPDL
GMELSTPLSKAAAGHGQPLQRLLLFYILGTVVAISLLLALALGILVCRKRRAKREIKEKK
PQNAADSYTWVPERAEGRENQYSPTPGSDC
Download sequence
Identical sequences ENSCPOP00000016677 10141.ENSCPOP00000016677 ENSCPOP00000016677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]