SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016682 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016682
Domain Number 1 Region: 36-203
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.77e-42
Family Dual specificity phosphatase-like 0.0000456
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016682   Gene: ENSCPOG00000022980   Transcript: ENSCPOT00000026006
Sequence length 215
Comment pep:known_by_projection scaffold:cavPor3:scaffold_15:23582393:23603396:-1 gene:ENSCPOG00000022980 transcript:ENSCPOT00000026006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSGDAKTNLTNAYPPAKGLFPRAQEAEAEDYCTPGAFELERLFWKGSPQYTHVNEVWPR
LHIGDEATALDRYGLQKAGFTHVLNAAHGRWNVDTGPDYYRDMDIEYHGVEADDVPTFDL
SVFFYSAAAFIDAALREDHNKILVHCAMGRSRSATLVLAYLMIHRNMTLVDAIQQVARNR
CVLPNRGFLKQLRELDKQLVQQRRQARGGDGEEEL
Download sequence
Identical sequences H0W144
ENSCPOP00000016682 XP_003473655.1.53824 10141.ENSCPOP00000016682 ENSCPOP00000016682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]