SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016749 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016749
Domain Number 1 Region: 130-173
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000593
Family Retrovirus zinc finger-like domains 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000016749
Domain Number - Region: 34-86
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000174
Family Cold shock DNA-binding domain-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016749   Gene: ENSCPOG00000019646   Transcript: ENSCPOT00000024677
Sequence length 183
Comment pep:novel scaffold:cavPor3:scaffold_25:9734947:9746400:-1 gene:ENSCPOG00000019646 transcript:ENSCPOT00000024677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSPGGCAKAAEKAPEEAPADAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALD
PPVDVFVHQVRLILVGFRSHGGGEGVDSVRKSTPHPKENAHKTEKAGTVYPCAKMKNRKP
KSKGLESRLPSTIRCYNCGGLDHHAKECKLPPQPKKCHFCQSINHMVASCPLKAQQAPSS
QGK
Download sequence
Identical sequences ENSCPOP00000016749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]