SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016767 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016767
Domain Number 1 Region: 66-107
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000193
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.04
Further Details:      
 
Domain Number 2 Region: 3-42
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000419
Family HLH, helix-loop-helix DNA-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016767   Gene: ENSCPOG00000005317   Transcript: ENSCPOT00000020057
Sequence length 107
Comment pep:known_by_projection scaffold:cavPor3:scaffold_20:6489242:6490096:1 gene:ENSCPOG00000005317 transcript:ENSCPOT00000020057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKESEVFYELAHQLPLPHNVSSHLDKASVMRLTISYLRVRKLLDAGDLDIEDEMKAQMNC
FYLKALDGFVMVLTDDGDMIYISDNVNKYMGLTQFELTGHSVFDFTH
Download sequence
Identical sequences ENSCPOP00000016767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]