SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017455 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017455
Domain Number 1 Region: 112-261
Classification Level Classification E-value
Superfamily C-type lectin-like 8.22e-33
Family C-type lectin domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017455   Gene: ENSCPOG00000020929   Transcript: ENSCPOT00000022177
Sequence length 267
Comment pep:known_by_projection scaffold:cavPor3:scaffold_28:4553249:4559427:-1 gene:ENSCPOG00000020929 transcript:ENSCPOT00000022177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LELTCSPREAMQDEDGYITLNIKPQKPAVSSGGQPENTVTSDSSSWWRVMALILLILSVG
MVVALVVLGFMFFFYLPVLNHPSHGCQYALNKDLAVTQQNNLQAENENLSGTVQKLARNF
CQYIIQQTEDHKCSPCETNWRYHRDSCYGFFKHNLTWEEGKRFCSNWNATLVKIASRSTL
FFLKSSSSEIHHSHWVGLSRQNSDKVWLWEDGSVLSDNVLHLILDFDGRENMNCAYFQNG
KIHPAFCNNRHYLMCERKAGMPRADLL
Download sequence
Identical sequences 10141.ENSCPOP00000017455 ENSCPOP00000017455 ENSCPOP00000017455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]