SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017510 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017510
Domain Number 1 Region: 146-287
Classification Level Classification E-value
Superfamily C-type lectin-like 1.52e-48
Family C-type lectin domain 0.00000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017510   Gene: ENSCPOG00000024312   Transcript: ENSCPOT00000026992
Sequence length 288
Comment pep:known_by_projection scaffold:cavPor3:scaffold_42:14920451:14925818:-1 gene:ENSCPOG00000024312 transcript:ENSCPOT00000026992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDENQYSEFLESPRKRRCRRGLQLALLGLLTSALWAGLLALLLLWHWDTLKNVKQLETAA
AQNVSRISEELQRHHSNQMAQKQKAELMSQTVQELRVEQTQMKSRESELSWNLDRLQEHL
SSVKSQNLNERHMASDALGKLKEEVAKLLMEIQMSEGSTCNTCPAQWVSFQQKCYYFGES
PKRWLQARYACEDLHGRLVSIHSQEEQDFLTKRANKEKAWIGLRDLDIEGEFTWMDGKPL
DYTNWQPGEPNNADQGENCVMMLSSGKWNDAFCHNWLDAWVCEQLATC
Download sequence
Identical sequences 10141.ENSCPOP00000017510 ENSCPOP00000017510 ENSCPOP00000017510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]