SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017685 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017685
Domain Number 1 Region: 56-200
Classification Level Classification E-value
Superfamily C-type lectin-like 3.85e-36
Family C-type lectin domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017685   Gene: ENSCPOG00000022859   Transcript: ENSCPOT00000022349
Sequence length 203
Comment pep:novel scaffold:cavPor3:scaffold_1034:12942:21918:-1 gene:ENSCPOG00000022859 transcript:ENSCPOT00000022349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTERTLQWHPLKVWFPAVMSISVLGICFILSTLVNKNNSVYSNIGKRLSKLQSHQRFLIC
LAQGTHNPTWSCCPTPWKLFESSCYFIASTSQSWEKSRESCIALQADLAVIRTQEEQDFI
IQNLNNSSAYYLGLSDPEGHRHWQWVDQTPYTNVTFWHEGEPNQPTERCVVVAFRPTTGR
WGWNDIFCDVPQKSLCRMPVIHL
Download sequence
Identical sequences ENSCPOP00000017685 10141.ENSCPOP00000017685 ENSCPOP00000017685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]