SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017794 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017794
Domain Number 1 Region: 137-237,405-476
Classification Level Classification E-value
Superfamily TrmE connector domain 4.84e-42
Family TrmE connector domain 0.0046
Further Details:      
 
Domain Number 2 Region: 88-168,205-395
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.18e-35
Family G proteins 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017794   Gene: ENSCPOG00000027093   Transcript: ENSCPOT00000028410
Sequence length 476
Comment pep:known_by_projection scaffold:cavPor3:scaffold_86:6187550:6190178:1 gene:ENSCPOG00000027093 transcript:ENSCPOT00000028410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRKLRSLAAWGPRRLCTAPGATIFALSSGHGRCGVAVIRTSGPSSLKALQSLTSLRLLS
DPRSGAPLDRALVLWFPARPFAAPGPRSFTGEDCAEFHVHGGPAVVNGVLEALGGVPGLR
PAEAGEFTRRAFAHGKLSLPEVEGLADLIHAETEAQRRQALRQLDGELGQLSRGWAETLT
KALAHVEAYIDFAEDDNLEEGVLEQADREVQALELALGMHLQDARRGQRLRSGAHVVVAG
PPNAGKSSLVNLLSQKPVSIVSSEPGTTRDVLETPVDLAGFPALLSDTAGLREGVGPVEQ
EGVRRAWERLEQADLVLAVLDVTDLAAPTSRDFLDAVVAPLACREPKGSSPHLLLVLNKC
DLLPSEGPCPRPGPYPYLLLSCLTGAGLDGLLEALKKDLAVLCGNPSTGPPLLTRARHRH
HLQHCLDALGHYRQAGDLALAAEALRIARRHLTQLTGGGGSEEILDVIFRDFCVGK
Download sequence
Identical sequences ENSCPOP00000017794 10141.ENSCPOP00000017794 ENSCPOP00000017794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]