SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017947 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017947
Domain Number 1 Region: 33-90
Classification Level Classification E-value
Superfamily BPTI-like 3.41e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017947   Gene: ENSCPOG00000026889   Transcript: ENSCPOT00000027187
Sequence length 91
Comment pep:novel scaffold:cavPor3:scaffold_45:11801355:11805149:1 gene:ENSCPOG00000026889 transcript:ENSCPOT00000027187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKMHQLCFSAALLALLATSVVGNQENETSVSTPVQRPAFCLERSFMGPCRILLIRYYYNA
HSGRCEAFGYGGCREKQNNFETKEECMRVCG
Download sequence
Identical sequences ENSCPOP00000017947 10141.ENSCPOP00000017947 ENSCPOP00000017947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]