SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018145 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018145
Domain Number 1 Region: 14-496
Classification Level Classification E-value
Superfamily ALDH-like 2.09e-182
Family ALDH-like 0.000000000000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018145   Gene: ENSCPOG00000021204   Transcript: ENSCPOT00000020208
Sequence length 501
Comment pep:novel scaffold:cavPor3:scaffold_21:24056042:24087740:-1 gene:ENSCPOG00000021204 transcript:ENSCPOT00000020208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMSSAKPAIPAPLADWKIQYTKIFINNEWHNSVSGKKFPVINPATEEVICEVEEGDKADV
DKAVRAARQAFQIGSPWRTMDASERGRLLHKLADLLERDRLLLATMEATNGGMLFASAYL
MELGMCIKGLRYCAGWADKIQGRTIPSDGDFFTYTRREPIGVCGQILPWNAPMLTLVWKI
GPALSCGNTVVIKPAEQTPLTALHMASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDVD
KVAFTGSVEVGKLIKEAAGKSNLKRVTLELGGKSPCIVFADADLDTAVESAHIGVFVHQG
QACIAASRLFVEESIYDEFVQRSVERAKKYVFGNPLNPGVNHGPQIDKEQYNKILDLIKS
GKKQGAKLECGGGPWGNKGYFIQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKTLDEVIKR
ANNTTYGLAAGIFTKDLDKAMTVSSALQAGTVWINCYGGGGNQCPFGGYKMSGNGREMGE
DGLYQYTEIKTVAMKISQKNS
Download sequence
Identical sequences ENSCPOP00000018145 10141.ENSCPOP00000018145 ENSCPOP00000018145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]